PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_010652-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 156aa    MW: 17729.5 Da    PI: 10.5422
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_010652-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.65e-071443130
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIart 30
                     rg+WT  Ed +l+d+++ +G g W+  +++
    NNU_010652-RA 14 RGAWTVYEDRILIDYINTHGDGKWRELPKK 43
                     89***********************99886 PP

2Myb_DNA-binding56.75.7e-184892147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg+ +teE+el+++++k+lG++ W++Ia +++ gRt++++k++w++ 
    NNU_010652-RA 48 RGNISTEEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 92
                     7999******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.4E-10543IPR009057Homeodomain-like
PROSITE profilePS500906.748942IPR017877Myb-like domain
SuperFamilySSF466894.21E-191289IPR009057Homeodomain-like
PROSITE profilePS5129424.6694397IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-224497IPR009057Homeodomain-like
SMARTSM007172.4E-164795IPR001005SANT/Myb domain
PfamPF002499.9E-164893IPR001005SANT/Myb domain
CDDcd001673.30E-125293No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MGRSPCCVKE GLNRGAWTVY EDRILIDYIN THGDGKWREL PKKADIKRGN ISTEEEELII  60
RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN TNLSKKLQAG HHTPEKQVVI NKSKGKKMVE  120
AAGTSALSTL SPKVSQEPPR VIRTKDVRCT RVFFPP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-17129725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010262233.17e-96PREDICTED: transcription repressor MYB6-like
SwissprotQ9S9K98e-45MYB3_ARATH; Transcription factor MYB3
TrEMBLF6HGP63e-60F6HGP6_VITVI; Putative uncharacterized protein
STRINGVIT_11s0016g01320.t011e-59(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.14e-46myb domain protein 3